SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2MHH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2MHH4
Domain Number 1 Region: 9-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2MHH4
Sequence length 216
Comment (tr|A0A0D2MHH4|A0A0D2MHH4_9CHLO) Radial spoke protein 11 {ECO:0000313|EMBL:KIZ00127.1} KW=Complete proteome; Reference proteome OX=145388 OS=Monoraphidium neglectum. GN=MNEG_7834 OC=Selenastraceae; Monoraphidium.
Sequence
METEPIYCAEQIVLPAGLDEVLKNFTKEAIRNQPHDLVDFGATYFAAQATLHKNLHAVEI
PTQQQLRDAFECLRATPTGPLIDVQAACRSVGISEATVASAVRAGNVNTGREVSVLEVLA
LLLSMRCDGLGAVLRNAFEVFGQRGGDSGDTSSNGSASARLEVPVLLQLLGFLGARDPEV
TTAMREGVARALDGHVSVDLKSLAGVPALASKLALA
Download sequence
Identical sequences A0A0D2MHH4
XP_013899146.1.7768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]