SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2MMR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2MMR8
Domain Number 1 Region: 9-133
Classification Level Classification E-value
Superfamily LigT-like 2.17e-16
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2MMR8
Sequence length 135
Comment (tr|A0A0D2MMR8|A0A0D2MMR8_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:KIY96055.1} KW=Complete proteome; Reference proteome OX=145388 OS=Monoraphidium neglectum. GN=MNEG_11910 OC=Selenastraceae; Monoraphidium.
Sequence
MYRNHLAFRRAAQPFRINFDDVACGASFHQCTYILCAKEPALLAANAAAREAFGKAEPGS
PYMPHLSLLYSDVDDEGRQQSAAAAVARLWGEGSGYDTLLPDGGFPAGSFSVWLTPVEDR
SLQSWQRVAEFQLAG
Download sequence
Identical sequences A0A0D2MMR8
XP_013895075.1.7768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]