SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2MQL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2MQL2
Domain Number 1 Region: 27-114
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000011
Family Prefoldin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2MQL2
Sequence length 133
Comment (tr|A0A0D2MQL2|A0A0D2MQL2_9CHLO) Prefoldin subunit 1 {ECO:0000313|EMBL:KIY96930.1} KW=Complete proteome; Reference proteome OX=145388 OS=Monoraphidium neglectum. GN=MNEG_11033 OC=Selenastraceae; Monoraphidium.
Sequence
MSKEKEDKDAQTLLELRDKLEMNGAYLAMVQNQQRRTGVNLRRAQLTLDEVQALPESVAM
YKAVGKAYFLAPKAELVSELSGDVKAGQDQAAELERQQERAVKAIKAIEGEVAEVARGNP
GAQQAFRRLMGGA
Download sequence
Identical sequences A0A0D2MQL2
XP_013895950.1.7768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]