SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2N7N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2N7N2
Domain Number 1 Region: 317-433
Classification Level Classification E-value
Superfamily TPR-like 0.0000759
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Weak hits

Sequence:  A0A0D2N7N2
Domain Number - Region: 247-345
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00785
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2N7N2
Sequence length 484
Comment (tr|A0A0D2N7N2|A0A0D2N7N2_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB08678.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_001G097200 OC=Gossypium.
Sequence
MEMYYLSRKHLNQKLFPSPHYYLSSLLFALSSKSLPPLCSTPQTQILSSHELHTIPTPHS
STPFISSSVSSPFPSTQYPFSRFLNKPDFSWFRGFSASSRTNASGKQVSEIINLIRRGSN
DLESKLDAMNIRLSEVLLNTIFRILNREKIPALRFFNWIRKSHPEFRHDSDIYSLVVDNC
GRSDDFDSIFNLLNDFRIHGICLNQKAFSYLPVMVSNQAAMKESICKTMEILNKIGGSCG
VTGTHALIEMLCALGSFEMAEYVITKTEKRLSNYGILIRSRSRKGHFEEAKRVLDEMTGT
GITPNCQIFNYVLGCLQKTDQTDKACQLLEFMVENGCPPNALTYEIFICNLCRHGKLDMA
FDWLNKMESKGIEPRPTTHAALIKGYFKLQQYEQAHQYVVVCSDKYKTVSNMIYSLLASL
YRKQGKPVMAQSVLSEMIEKGLSPNFTVYMHVRKHLQKIGREDLARNLESSFSCFISQPS
AVNG
Download sequence
Identical sequences A0A0D2N7N2
XP_012472896.1.20347 Gorai.001G097200.1|PACid:26821161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]