SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2PA97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2PA97
Domain Number 1 Region: 130-220
Classification Level Classification E-value
Superfamily TRAF domain-like 1.37e-22
Family SIAH, seven in absentia homolog 0.00074
Further Details:      
 
Domain Number 2 Region: 70-117
Classification Level Classification E-value
Superfamily RING/U-box 0.00000482
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2PA97
Sequence length 238
Comment (tr|A0A0D2PA97|A0A0D2PA97_GOSRA) E3 ubiquitin-protein ligase {ECO:0000256|RuleBase:RU201113} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_004G114600 OC=Gossypium.
Sequence
MEFDNIECVSTTDGINEDEIHHHNLQHPHPHHAHHQFSSSKPHNATNTTNNGNTTTNNIV
GPTAIAPATSVHELLECPVCTNSMYPPIHQCHNGHTICSTCKTRVHHRCPTCRQELGDIR
CLALEKVAESLEMPCKYYNLGCPEIFPYYSKLKHEAMCNYRPYNCPYAGSECSVVGDIPF
LVGHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWMLTVCFIILLWHLLFFQRVPLF
Download sequence
Identical sequences A0A0D2PA97
Gorai.004G114600.4|PACid:26774343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]