SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2PER7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2PER7
Domain Number 1 Region: 54-187
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 7.67e-32
Family Pollen allergen PHL P 1 N-terminal domain 0.00063
Further Details:      
 
Domain Number 2 Region: 191-283
Classification Level Classification E-value
Superfamily PHL pollen allergen 2.88e-18
Family PHL pollen allergen 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2PER7
Sequence length 289
Comment (tr|A0A0D2PER7|A0A0D2PER7_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB25458.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_004G192500 OC=Gossypium.
Sequence
MGYSGCLASHLISNLIQLHSPLLLSSFLCLISFCSQKKNMGFSLKLQYCLVSVMVLLPAV
CYSQDYFVKSRATYYGSPDCLGTPSGACGFGEYGRSVNDANVAGVSRLYKNGTGCGACYQ
VRCTNPQICADNGVNIVVTDYGEGDNTDFILSPRAYARMAQPDTGAHLFAYGVVDVEYQR
IPCQYSGYKTQVKVHEHSKYPNYLAIVVLYQAGKSEILSVDIWQEDCKEWIGMRRAYGAV
FDMANPPSGDISLRFQVRGSAGLTWVQAPNVIPKYWKAGVAYETDIQLY
Download sequence
Identical sequences A0A0D2PER7
Gorai.004G192500.1|PACid:26777671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]