SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2PLA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2PLA1
Domain Number 1 Region: 306-445
Classification Level Classification E-value
Superfamily ApaG-like 3.92e-27
Family ApaG-like 0.0003
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily F-box domain 0.000000000409
Family F-box domain 0.0048
Further Details:      
 
Domain Number 3 Region: 94-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000235
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2PLA1
Sequence length 445
Comment (tr|A0A0D2PLA1|A0A0D2PLA1_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB27858.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_005G015800 OC=Gossypium.
Sequence
MGKELDGLGYLPLHIILSKLSPSDIIKVSCANKRLRASASDESLWAQICYQELQLSTPQD
DHGNPLPCFMLAYQLWREAFSMYPWPLVKRVKRCWDKLKKWFNNNFPEAEATLRRGASES
DIEQLQTLLKVKLPLPTRLLYRFHDGQELPEKRNPKTASGSWLGIIGGYSFYNHSVNVYL
LPLNQVIAKTRYVIRHLGFSSRSKCIVMASSFTFSRKVFFLNCTNGQLFVGTRKPLTDGE
MIPCVPNALIRSVHDLYGEEQQDAMLLWLEEHGRRLENGIIKVRKEGDDRSINLFPEVPP
LCVTTVTNGVQVRASAVFVPEFADLVDEAEKFTFAYSIRMSLLPEGCVINGMTFVSCQLN
RRHWIIRADGEVVSSVDDEAVIGEYPLLHPGEGEFVYQSCAPLPSPSGSIEGHFTFVPGR
LADPRGGPFEVQVARFPLEMPDYVF
Download sequence
Identical sequences A0A0D2PLA1
Gorai.005G015800.1|PACid:26803952 XP_012481531.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]