SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2R0F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2R0F0
Domain Number 1 Region: 122-223
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.86e-21
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2R0F0
Sequence length 254
Comment (tr|A0A0D2R0F0|A0A0D2R0F0_GOSRA) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_007G276900 OC=Gossypium.
Sequence
MTSIMDAERDKYSMINFEETELRLGLPTGIENDNETAKNNGKRGYSDMVDLKLNLSTTKE
ASVDEAEKMKEKNTAKPPAKAQVVGWPPVRSFRKNIMTVQKNSSDNKGEKTGSGNTINTA
VPAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGK
LIDLLNGSEYVPTYEDKDGDWMLIGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKE
QKLMLASLQNNNLS
Download sequence
Identical sequences A0A0D2R0F0
XP_012492786.1.20347 Gorai.007G276900.1|PACid:26778640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]