SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2R2A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2R2A1
Domain Number 1 Region: 164-276
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.4e-17
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2R2A1
Sequence length 287
Comment (tr|A0A0D2R2A1|A0A0D2R2A1_GOSRA) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_004G222500 OC=Gossypium.
Sequence
MQGGGGGGSESGSMSTVSRDENMVVSSEDSSCPDESGLELGLGLSLGGGGGGGRQGGGFK
MHHVSKGGPYARILTAKDFPSPSSSSSSSSSSPSLSKASVTAGTKRTAESVAVAANGSSQ
VVGWPPIRAYRMNSMVNQAKVLTMENRKKETSMVENSTIGGYRNNGNTKMKKSTFVKVNM
DGTPIGRKVDLNAHESYEKLAKTLEDMFLETVPSVNPSGSTALQLDMLNRMTRHSKLLDG
SSDFVLTYEDKEGDWMLVGDVPWEMFLTSVKRLRIMRKSEATGLAPR
Download sequence
Identical sequences A0A0D2R2A1
XP_012476298.1.20347 Gorai.004G222500.1|PACid:26776700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]