SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2S755 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2S755
Domain Number - Region: 239-277
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0235
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2S755
Sequence length 423
Comment (tr|A0A0D2S755|A0A0D2S755_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB59063.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_009G237000 OC=Gossypium.
Sequence
MSPSGDGAINGGCCCSCSPGENGGYDGATNFGISASHDETCMHCPRSEPSSCSSSELGFD
PVLLTDSERLRRIFVASAKGFSIGAGLQGGLAIFSILARLRRKKPKKVEAFSDKEAISMA
IKETLRYGIFLGTFAGTFVYVDETVAACGGNHRTAKWRALVAGLVAGPSMLLTGSNTRHT
SLAIYILMQAAVLASRCGIKSKRFGKFCKPLTWKHGDIFLMCLSTSEILSSYILKQDCLP
PSYKSFLNQHGGKDIVILQGVKELASDLPFTTLEAIEKIYKATGVDVKLDPNMKIPCSMV
HGNKSCRAHAITFLIEAYKRALPVYLPVYLIPALIVHHQGLFKRPCTILGKGIVDIARSS
LFLATYCTSAWMWTCMLFGFLRRCSIPLIAIGSVKDSFNLSYLEYPCSTYIQTSMTRQIH
SKA
Download sequence
Identical sequences A0A0D2S755
XP_012446368.1.20347 Gorai.009G237000.2|PACid:26762731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]