SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2T6W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2T6W0
Domain Number - Region: 88-119
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0772
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2T6W0
Sequence length 171
Comment (tr|A0A0D2T6W0|A0A0D2T6W0_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB52314.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_008G255300 OC=Gossypium.
Sequence
LRKKSGRKKKTEHTHKKMKPTRESMVTNRRQLTPAQRSAKIERDRRRRRERNMEFERLQK
AETELQALTAAQRNENSCLRHHNERLNDMVSILENIIHQLREQNRELQQKNLGLEQTMKL
ADSWLRQSPNEEVSNNQPSTEGPRSSQSRIPYAQRISDLLIDQHTSDAKHA
Download sequence
Identical sequences A0A0D2T6W0
Gorai.008G255300.1|PACid:26813829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]