SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2TCP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2TCP4
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0000196
Family N-terminal coiled coil domain from apc 0.005
Further Details:      
 
Weak hits

Sequence:  A0A0D2TCP4
Domain Number - Region: 16-53
Classification Level Classification E-value
Superfamily AF1531-like 0.034
Family AF1531-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2TCP4
Sequence length 119
Comment (tr|A0A0D2TCP4|A0A0D2TCP4_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB52316.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_008G255400 OC=Gossypium.
Sequence
MNRRRPQLTPVQRSAKNERDRRHRALKKMEFERLRNEKMELQATVEELRNENTSLRRGYE
RNNDDISNLQNTVRQLREQKEELRRKYLELQEIVKQAQSYFKFDEFPSPNEEAPNNETA
Download sequence
Identical sequences A0A0D2TCP4
Gorai.008G255400.1|PACid:26813860 XP_012439785.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]