SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2U605 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2U605
Domain Number 1 Region: 53-249
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 9.02e-62
Family Chlorophyll a-b binding protein 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2U605
Sequence length 252
Comment (tr|A0A0D2U605|A0A0D2U605_GOSRA) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_008G194000 OC=Gossypium.
Sequence
MSAVTTQASAAVFRPCMSKTRFLTGNSGKLNREVCFKSMSSSSISSFKVEAKKGEWLPGL
PSPAYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGL
INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQYSLPPH
ECGYPGGIFNPLNFSPTLEAKEKELANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDP
WHNTIINTIRGY
Download sequence
Identical sequences A0A0D2U605
Gorai.008G194000.1|PACid:26816155 XP_012438776.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]