SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2UW16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2UW16
Domain Number 1 Region: 21-153
Classification Level Classification E-value
Superfamily GINS helical bundle-like 8.37e-40
Family SLD5 N-terminal domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2UW16
Sequence length 220
Comment (tr|A0A0D2UW16|A0A0D2UW16_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB72861.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_011G201500 OC=Gossypium.
Sequence
MASGAGKWSAEQIDDYEALISTTDVELLKRAWRNEKASPEILPFEEALLKRAKEQIQLME
ETVDDFAESGHDPLIASLYQMDLDRAQFLLRSYLRVRLQKIEKFMFHIWKMDTYRNRLSI
EEEKFTERCIRDIGKHLEETVLSKLPDNYQSVLKQSIISEEDDMVPEPQLDTFVVAKCER
ATKPLYLDGSRQSASFDRMTTFKWCLEIYAFCVTGPFKRN
Download sequence
Identical sequences A0A0D2UW16
Gorai.011G201500.3|PACid:26811528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]