SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2V1M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2V1M0
Domain Number - Region: 167-198
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0641
Family Outer membrane lipoprotein 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2V1M0
Sequence length 262
Comment (tr|A0A0D2V1M0|A0A0D2V1M0_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB75424.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_012G041600 OC=Gossypium.
Sequence
MTTRSDENEAKLKELSKKLEALQKEKLELRSENKEVKETIEKLTLEIDEFRHREVETKTE
TDQWEDEMVLESLASRSAELENEVSRLQHDLITSMSEIDEANKDAVELKRGLEEKAWVIE
GMEKEISELKKEKLEIEKRERDLERKLGVLEVRETEERSKKVRLEEEMKEKIDELKKKAN
ALQAEVARTKAELDKTNAEIVEFEERATLLESNMLEVKEGVEGKTSGAIKGRSKVKGWLL
GVPAVAILFAAAVVFLCSRQRS
Download sequence
Identical sequences A0A0D2V1M0
XP_012459993.1.20347 Gorai.012G041600.1|PACid:26828580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]