SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2VIT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2VIT7
Domain Number - Region: 237-276
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0981
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2VIT7
Sequence length 308
Comment (tr|A0A0D2VIT7|A0A0D2VIT7_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB83741.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_013G261900 OC=Gossypium.
Sequence
MFTLCIYPCLSISLCFSLSHKDLNFLLKTHFGFSVFCLSLPSITLMASIIESGWLYLITH
FSDFQLASMGSFLLHESVFFLSGLPFIYLERAGLLSKYKIQTKNNTPTAQEKCITRLLLY
HFSVNLPLMIVSYPVFRCMGMRSSLPLPSWKVVLTQIIFYFILEDFVFYWGHRVLHTKWL
YKHVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPAITGPHLITLWLWMVLRVLETV
EAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVYMDCTLVLHLCLMHVH
EALDHYSL
Download sequence
Identical sequences A0A0D2VIT7
Gorai.013G261900.2|PACid:26790899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]