SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2VLR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2VLR2
Domain Number 1 Region: 546-594,681-757
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.22e-19
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 
Domain Number 2 Region: 894-995
Classification Level Classification E-value
Superfamily PX domain 4.71e-19
Family PX domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2VLR2
Sequence length 1314
Comment (tr|A0A0D2VLR2|A0A0D2VLR2_CAPO3) Uncharacterized protein {ECO:0000313|EMBL:KJE91062.1} KW=Complete proteome; Reference proteome OX=595528 OS=Capsaspora owczarzaki (strain ATCC 30864). GN=CAOG_002257 OC=Eukaryota; Ichthyosporea; Capsaspora.
Sequence
MPGEVAAWLQRHALSPAGVILALLCAWLGPLSLLLRIVVFVVAFVSSLALFTRYARLASS
RLVSSSLLVYNVPGATMRGQLTVRTANGIASILDAVQADCVVDAAASTGSARLHGAAAHA
STASVPGAATGVVGASSSTVSNATAATNSLSNLNTSSRQQQQQAKVDRRMTGSSVVDDVL
HNLIDLHLRDYVDWWYKDVSDDPSFLLALKAMASTATVKFANRAKAVDFVNFATVNVVDE
FVLHLRYFTRAQEKARELTVAGGSPGASDAGGDEVIAADLIDRFFFESEKRHTAICKSRE
AEQAYLRDLSELLLYILLSPADFANKPLRILLREMCVNVIFLPFIDSISDPDYINQTIVS
ALKTSTVSYESFLNAIRSAETVEDVEVMLYQVDGELSRYQGAAARAEAIRAAEPSGAPIG
FVSLFMPVFPMSGDYAVDAYGDGSDSSSFLSSSGISAAEPSGTLAAASAVATKASTSPVE
NTGSVVGTIFATPSSDGEFDAQSNRRHINRLVVARSECEKRLRELSRSSGFYVQSSMRDK
TPMRLLSLADILSSNVALSYFMAFVEPEGASATVLLDFWLTVEGYRASAEQRSERLHALA
DQLGSDDTHRQVMRPRSDSQSSQMSHMNHDDFDFDDDDLGAKPSFRVATNQSALQSQSAG
EEIDDSTSNSTRRTHDALKSMLQDEANVVFEQYLATTASPRVPTDDRIINNIGREIAHGH
YATCFDEAQQFAFKLIERDYCPRFQLSDGYVRCLGDMEMLGPSTTGDGASLESGSSTAAS
HLPTVAASAARPVPGAAAAASRGDFASDTSSPSSSLVPPLSSSLTSSSQMTRSPSMSSLA
DDDRDGAGAGVGADHDGFARGAQSRSMSMMNNAPVAAPPRPSLSALHSSERASWNATMRD
FEIRKEDGDKVAVFIIDVMRKDEFGVLRWEVVRRYSDFHDLHMQLRANAPEVAQKLELPP
KKTFRNLETQFLETRKQALATYLHILVSPEALRNAVAEDFVSSFLSDGAYEKTAGGIARK
MDTFVNPIKSTVKTVKTKLKDEMETLFSANPTKSSTGVGLDGTGGGSGGGGGIGSGDGGL
GDGGGEFDEDGTWVPHELPAMRKQGAAAAAAPPKESKDGRGRAPSVEEWKTAAGDGDDDN
IPFRILLALLDEVFELKHRNKWLRRRVMALLRQIISQTFGDTINRIIVDQIDLMTSADKV
AEYLQMYQDAWWPDGVLASAYPPRTPEERLHAKIEARTKLLSVLTDDLKRIVGSENCRRG
SARIFEMLQHASLNRRLFYTLFESFLTTLFGDYNLSELIARLHAGKRKKTIAAN
Download sequence
Identical sequences A0A0D2VLR2
XP_004349007.1.32957 CAOG_02257T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]