SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2WJA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2WJA7
Domain Number 1 Region: 51-251,282-488
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.13e-31
Family LacY-like proton/sugar symporter 0.079
Further Details:      
 
Domain Number 2 Region: 631-758
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.68e-17
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2WJA7
Sequence length 775
Comment (tr|A0A0D2WJA7|A0A0D2WJA7_CAPO3) Uncharacterized protein {ECO:0000313|EMBL:KJE89418.1} KW=Complete proteome; Reference proteome OX=595528 OS=Capsaspora owczarzaki (strain ATCC 30864). GN=CAOG_000889 OC=Eukaryota; Ichthyosporea; Capsaspora.
Sequence
MPSSSSSSSSSSTPSSTSVGAGAASSSIQSGNGGSAGLLQRESRVLFGLLPTRLFNVLWL
SISFFVLFSAYNTLQNYVTSLLPGNLGNVSLAVLYCTVAASVFSAPFIVARFGERKTMVF
GAACYVVFMISLIEIVYGVVVFCSMIIGFGAGILWVAEGSYLTKNSLDSERGRNSGMFWG
IFQLCNVLGNLVAFFVFQAFSSTTLFVMFTVLGSAGVLLMCLLRAIPPEVHALNVATARS
KKEARHLLHASDGQRGAYSNHADDDDDDEDDGESTLADQVKNMTARQIASEIIQVFKQPG
MLMLMPILFWCGIELSFWAGEFTQLLDSNIIGFVLMFAGIGDALGAIVIGYVSDIIGRSV
TMLIGVAVYATALFGTITLYNHPYSDSDVCVSGYCVPWYALTSAFCFGVADAVFNTQVTA
IVGSMFAKKSVSAFCVYQFAQNVGSAIGFFYPLLVPMHGDDKSLTQVWLQVSLLSVAATL
FILVDRFRLKWRLVNMSTSKPSSAVAPSTHTRNRDGYMPLSTSSSDPAHVGGDTSSSPIA
FAPKPTRSSAASLASSTRVSGQHSVTGVNAAIDNESVVMGGSGSAFARPPSRQSAHGSLP
TNIPPNPNSNRESAGAIDPKLNGKGEKGDLLETIFSSPPLLAAFSAHCGRVNCQENVDVC
VAIDQFRKLPSDGQVRLGEARRIVDTFIVPGGPQQVNIDARMQQRLIQLINSLAQSAAAN
PDATIDLPANTFDGVDRLIRFYLLNDICPRFVLTGEFRRANSQWRAESSQLLQSL
Download sequence
Identical sequences A0A0D2WJA7
CAOG_00889T0 XP_004365760.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]