SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2WQF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2WQF2
Domain Number 1 Region: 594-707
Classification Level Classification E-value
Superfamily PX domain 2.09e-26
Family PX domain 0.00052
Further Details:      
 
Domain Number 2 Region: 453-572
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.71e-24
Family Regulator of G-protein signaling, RGS 0.001
Further Details:      
 
Domain Number 3 Region: 216-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000254
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  A0A0D2WQF2
Domain Number - Region: 247-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000174
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2WQF2
Sequence length 727
Comment (tr|A0A0D2WQF2|A0A0D2WQF2_CAPO3) Uncharacterized protein {ECO:0000313|EMBL:KJE93113.1} KW=Complete proteome; Reference proteome OX=595528 OS=Capsaspora owczarzaki (strain ATCC 30864). GN=CAOG_003950 OC=Eukaryota; Ichthyosporea; Capsaspora.
Sequence
MEGFVAQLVAHESAVAGAISAFLAACNARPVVRQLPVVQTSKQLVTAFQGLVQAVTALEH
AVPDQEVAEIRISRDAINSAASQFLALLKTLLGGATASANGGGDPTNGGATTDDVTERTQ
RFMPSLVECLIQLAKHCKELVGHAKRLASSQTPARVASPVAATPQASHPPLPPPNLRGLG
GHASPPPAAAAAAAAAAAAATPITPTTGATNGVATAVVCAKCTKPFTAGSKLLQYQGRLY
HQDCFLCGKCARPITSPEFLILNNACLCNACSPSCRTCSRTIVKDHVSAFGENYHRDCFR
CVECNQPITNLSKFYRRQRGACCPNCIQAVFERRWSPSMQTTIEVPPSPTAHSSHANNHS
NRNNSNNDDRDNPYIPRPSSAHVVSNSEPQYAEVGAALDRNTDEDSNDDLRFVAEERSRS
KTHPLAQNVLPAAVMASMTAAQPPASSSSLGPCHLDQVLHNDFGIDMLIKHCAAEYCIEN
LFFWLDVEQFRNFDGDLDDVMLYAKSIDHKYIMSGAELFVQFPEPIKALIQARMSAPELP
MFDDAQRWVYGEIEASVLPRFLKSEFGKKYVERVVQELNKQSDRIVSDFYGGALRAWISN
FEKRHDPEKYYVYELTVERGTARFVVYRRYSQFLRLERELETRFPTESFPSFPPKILFRR
SHVRDVAKVRMRDINAYLEGMLSMRPHISNCDIVQNFFAQTDQDAKDEEFNKRLSMVGAG
RRPPSAR
Download sequence
Identical sequences A0A0D2WQF2
XP_004363678.2.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]