SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2X8F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2X8F8
Domain Number 1 Region: 199-311
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.19e-29
Family GS domain 0.0039
Further Details:      
 
Weak hits

Sequence:  A0A0D2X8F8
Domain Number - Region: 115-152
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 0.0327
Family Phycoerythrin 545 alpha-subunits 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2X8F8
Sequence length 316
Comment (tr|A0A0D2X8F8|A0A0D2X8F8_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNA93808.1, ECO:0000313|EnsemblFungi:FOXG_00167P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_00167 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSQKCVHQGCGKEFTDPDEKCEYHPGPPIFHEGQKGWKCCKPRVLTFDEFMDIPPCTTGT
HSTTDKPPQLEEKPQQDDAALAQKIDALNAATPSRAPIPTAQHAPTPPPPAPESEDDDPS
LEIADGVGCKRRACGATYKKGSSRDDEECVHHPGVPIFHEGSKGYSCCKRRVLEFDQFMK
IEGCKTKNRHLFVGSGKKDGANSEEVVSNVRHDFYQTPVNVIASFFLKKIDKSTAKIELE
PKQLSLDLTTTDSPPKRYTAEVPLYASIDPKKSSYRVLGTKLEFVLAKSDGTSWPVLRGD
EALTGEILQVGRAGRA
Download sequence
Identical sequences A0A0D2X8F8 A0A2H3TAJ8 W9IMI5 X0B2Q6 X0C4K7 X0I514 X0N783
XP_018231854.1.49799 FOXG_00167T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]