SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2XU62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2XU62
Domain Number 1 Region: 448-770
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.84e-48
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 774-1114
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.83e-35
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 1134-1177
Classification Level Classification E-value
Superfamily RING/U-box 0.00000942
Family ZZ domain 0.024
Further Details:      
 
Domain Number 4 Region: 298-378
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000248
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2XU62
Sequence length 1231
Comment (tr|A0A0D2XU62|A0A0D2XU62_FUSO4) Uncharacterized protein {ECO:0000313|EnsemblFungi:FOXG_07514P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN= OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MVWYAKCLTKTIVKVNDAFLGTQMLTQANFVNVVSNLHLEPSQQTGLRVALRKVINQASP
VLPYLQADEDWQHPDLLDLPERAKTIIVHMRCSSGAEAATENASFFLNNRSGTYHPLLYM
KFDAHDIRFNTCEAMLRTFIARISCNRLQTENTVSRTMDTLINFEALHRVTLFNEAERLQ
SIQEYVRTINYDPEEPIPFPVDMEASKLMKELDETERHEMVLRTCIDYIQDAAENPDDAT
LHLPYAIEFWPKHWQLVETSEKQVVDLFENDTVFEFWANSLVGLKNTLLKPPPKHIKPLP
VAAHLGLTTVAETLLRRSLDQPESRDQALIEACRAGHVAVIRLLVRSYSDGLDFGDENLH
EAARVAGNSYNSEALREIVNGLPEPPKTASVQECTRHEFEANSKPTKSQEKNDQQDNSSD
GAMKGEQEVKVMKSEEHVSGPLDWLVMPMNRAVKSGMDDVVTRLLQLGVDPNPPKGITPY
GNSFIYTAANTSNISCAKLLIEAGANPAARNDQGHTPLHTAIDWASGETVEFLLEHGASI
EDEDPENRRALDMAASWGSFTALEIILQQKDEAISMGDLGMVKLLIEHGATIDKREAPPD
EGWSRTPHIFQYLLEKGADPNARDSDDIPVIGAAVDGGHTNMVKWLVEASAEVNATYFEA
KSTPLHEATAYPEMVRLLLQHGADISKVNAYSRTALNYAICANSLAAVQIMLEETKAKFD
LGAANIEPDLRVAVSSGWTEVVEALLEAGADVNAIDEENKSLLACAMTKGASIDMIRKVL
EYNPDLELKDNKQNTALHCINTSTSLDTVRLVVNAGGKLNVLNSENETPLIYAIRAQLDD
VFSYMLRKEPALLNGSVALSKQSVTPLHEACRAGTLAMVRSLIEHQVEVNSTCKDVYGTP
LIAATLRSDVASSGLASEIIALLLVNGADPKVPAGLFRYPLISACLACPNDTMKLLLNSD
ASPLDQDSLTRKPVHLSCYNSLDVLNLLEIPDSDFSARDIVGRVPLHYAVMRGDVELVQA
VLERSKRAGIDIDVKDDDGWTPLLWAFRASPIWNHQLVDPVSTLQVVSLLVKNGADINAK
GHGSGKDWTFHDVAYYHHAESIDMLLDQKSAASEGNSPAKKRGSLPVPPGDESWFCHCCL
LESHGIYFKCSSCHDFTLCYKCHWSSSKTHPDHSSYIRHGSEWYDDSTSEQEKISEMGID
DDGRDEDVLLDREEILYEDFDSEMSDEASEH
Download sequence
Identical sequences A0A0D2XU62
FOXG_07514T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]