SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2Y028 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2Y028
Domain Number 1 Region: 324-467
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-21
Family Regulator of G-protein signaling, RGS 0.00089
Further Details:      
 
Domain Number 2 Region: 207-305
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-18
Family DEP domain 0.012
Further Details:      
 
Domain Number 3 Region: 22-149
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000117
Family PadR-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2Y028
Sequence length 479
Comment (tr|A0A0D2Y028|A0A0D2Y028_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNB08915.1, ECO:0000313|EnsemblFungi:FOXG_09613P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_09613 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSKGTITQSSSRLLCASNDDRPQSKDLQDLFSALLASLLPLVPHRVRFIKIEHTFLAEDA
IHNLGNLKLTQSNRMPDPSNPSGTVVSTSTTTFSMNKNTARNLCQQFVDARYIESADGKP
DQVFQQRGGVWRPTSKGIMIFDWFCQSNGLYQDQLSELHCLITGPLLHLERDVKTDKCHV
DRATTEVVFCRLIGVDGRGKKGPYSEGAAGIRLQPERKVNGKTYHDTCTGQVIAEWLRDN
TTCVDLREAVNMATHFVHYNLIESVTTDMAYMNQFAACKLFQPTPIAIYQLSQRGQDLVE
TSSSSRCSSQGKTDSSSAKGGVNESNRHKLEKILLDPTLRLLFRENLRETYCEESLAFYE
QADEIIRDSKAMLETMLKDKKGDDAANELLSQAHVVFNTFLAPGSPREVNVNHKIRSSLA
QRMTKAQALDATVADTLKEVTSLLETAQDAVFKLMATDSVPKFLNNPAAESRLVQAGVR
Download sequence
Identical sequences A0A0D2Y028 A0A125RK47 A0A2H3TP81 F9FXW8 N1S3H4 N4UJK5 W9HUJ3 W9NR26 X0A8B5 X0HG59 X0JB09 X0KTS4
FOXG_09613T0 XP_018246960.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]