SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2Y041 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2Y041
Domain Number - Region: 317-361
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0883
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2Y041
Sequence length 548
Comment (tr|A0A0D2Y041|A0A0D2Y041_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNB08942.1, ECO:0000313|EnsemblFungi:FOXG_09628P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_09628 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MVRSLSDESEHDGIGRWFDNDDETVQSPQPISMEEDQELKEIPIDVVGSPKETIAWLTDL
RQKTEEVRLLHPVTDVPSVSSVPSLNLSDETMSCSTRSVHNAAGLSTDDETTTMSQRGLA
TIEYGYDENAQDVASDSSSDSSGSLSPVSCLSPSNTNITSPGSDGSDQDSIESIDDIPES
AYESYSAETARMGLQGSYWAYGSDLETSYSDQHHQACDADDDDNSEANESTRREEPTAAE
VGSCTGSTEANGLVQHKDQPPKRAAQDDENEHQQVSRAKKSKKQEDSHLRLACPFYKHDP
IRYRRCHAHVLKRNSYVKQHLFRCHMQPIHCDICLSIWSNVEELREHRRAQICEKREYIA
PDGITPEQERKLRSRLGSQNKSESDQWFELYSILFPYAQKPKSAYLNGELSEDAESLREF
IEGRGTNVMMEQLKRSGLILNGENNSRGVDIELQNSLQNALSTMFEGWQNQRRGVDEDDG
GRQTKRLKPTPGEFPSNKTQMPVRTDTGSTNTTATMMDDQIEGEQTRPTTSSSQQKGEIV
LGLWKSPS
Download sequence
Identical sequences A0A0D2Y041
FOXG_09628T0 XP_018246987.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]