SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2Y068 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2Y068
Domain Number 1 Region: 352-395
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000811
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2Y068
Sequence length 557
Comment (tr|A0A0D2Y068|A0A0D2Y068_FUSO4) Uncharacterized protein {ECO:0000313|EMBL:KNB08978.1, ECO:0000313|EnsemblFungi:FOXG_09656P0} KW=Complete proteome; Reference proteome OX=426428 OS=9935 / NRRL 34936) (Fusarium vascular wilt of tomato). GN=FOXG_09656 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MATSRPKHIEPEHLRFEFLLRHVDDEPSIADTRSLTEAVRRIIQTAVNFAVVGEVDGATR
LLETLTIRGIDPFQYSDFEYPFLKPCMFFAWEATSSWPSWVPEEERAEGKLQELEAEGRK
HWLERFSQEWEVTDETAEKALDMAYNGLTTKLPDYNGTLAGQVIQAEAMAVNGDFSYSAS
PNGPMAIRYMKIAMWWRQGIFPYPFVQLYRTAGLMIALDIYLRLGKDEKARELFMKVCDR
FHTEEQVEQLACSRAAWKQTLAVPERPLLDFLNIHAAKLRPAVSRACQMAENRLQGGPRR
RYAGQSIEKLVHIISENTFKNCPYDRLDAYRPPGNLRDRPRNANALIRRGCYVAGIRALE
QRLGVTLPEDYKEFLSITNGLDSMWDGQNLVDYLAAAQEVNWQEIDFLEGNELPLLNDGE
PLAWTKNILEWPKVEKPRCISLSGDISHEERAGHFFLIGQDLLQPAKDYFFKTYEERDEV
QRRELDRLVEETYGSMENFRNLEWGFISWTAWDFTVYPYHGLQDFLEQMAEASLRQERPW
LNMFEPRFRRTANVDDA
Download sequence
Identical sequences A0A0D2Y068
XP_018247023.1.49799 FOXG_09656T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]