SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3BPL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3BPL0
Domain Number 1 Region: 33-69
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000000655
Family Hevein-like agglutinin (lectin) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3BPL0
Sequence length 127
Comment (tr|A0A0D3BPL0|A0A0D3BPL0_BRAOL) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bo4g020900.1} KW=Complete proteome; Reference proteome OX=109376 OS=Brassica oleracea var. oleracea. GN= OC=Brassica.
Sequence
MKYAKTTSRNDQFAILLTTLFFLILAVSKPVASQNCGCASGLCCSSAGFCGTTDEYCGEG
CKEGPCKNSGPGDPTVSLEETGVTAEVEDSTPTKPLWQQLMPIRASVLPSPNVKSLPSSL
TLPRNQD
Download sequence
Identical sequences A0A0D3BPL0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]