SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3BRK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3BRK6
Domain Number 1 Region: 77-143
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.57e-29
Family AN1-like Zinc finger 0.0000439
Further Details:      
 
Domain Number 2 Region: 15-58
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000641
Family A20-like zinc finger 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3BRK6
Sequence length 149
Comment (tr|A0A0D3BRK6|A0A0D3BRK6_BRAOL) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bo4g034790.1} KW=Complete proteome; Reference proteome OX=109376 OS=Brassica oleracea var. oleracea. GN=106337329 OC=Brassica.
Sequence
MAEEHRCQTPEGHRLCVNNCGFSGSSATMNLCSNCYGDLCLNQQQASSLPAASPPSSSKI
ESISSSSTAERQIKLIPSEQKQPPQRPNRCTVCRKRVGLTGFVCRCGTTFCGTHRYPEVH
GCTFDFKSAGREEIAKANPLVIAAKLQKI
Download sequence
Identical sequences A0A0D3BRK6
XP_013631881.1.26608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]