SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3DYA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3DYA0
Domain Number 1 Region: 35-80
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000541
Family Ribosomal proteins L24p and L21e 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3DYA0
Sequence length 145
Comment (tr|A0A0D3DYA0|A0A0D3DYA0_BRAOL) Uncharacterized protein {ECO:0000313|EnsemblPlants:Bo8g110990.1} KW=Complete proteome; Reference proteome OX=109376 OS=Brassica oleracea var. oleracea. GN=106309378 OC=Brassica.
Sequence
MFQTRNITKAKHVIRPHVLRPTDSGRTRFKLYIRFRFYHGRTGRVWNVTKRAVGVEVNKQ
IGNRIIKKRLHVRVEHVQQSRFAEEFKLRKKKNDELKAAAKARVETISTKRQPKGPKPGL
MVEGMTLETVTPIPYDVVNHLKGGY
Download sequence
Identical sequences A0A0D3DYA0
XP_013601859.1.26608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]