SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3FIU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3FIU0
Domain Number 1 Region: 34-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000218
Family Heat-shock transcription factor 0.0077
Further Details:      
 
Weak hits

Sequence:  A0A0D3FIU0
Domain Number - Region: 173-217
Classification Level Classification E-value
Superfamily Heme oxygenase-like 0.0667
Family Eukaryotic type heme oxygenase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3FIU0
Sequence length 274
Comment (tr|A0A0D3FIU0|A0A0D3FIU0_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART03G18430.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAFLVERCGGEMVVSMERSHGRSTTTAAAVTAAPAPFLSKTYQLVDDPSTDDVVSWGEDE
ATFVGFRKIVADRWEFANEFFRKGAKHLLSEIHRRKSSSCSQPQPPPPFPMHQHYPLSLF
SPPTTTRSLPVGAAAAAAYHFQEEYCSSPADYAGGGGDLLAALSEDNRQLRRRNSLLLTE
LAHMRKLYNDIIYFLQNHVEPVAPPPLAAATSCRLVELGPSTTERRRSAASPSGDNDDDA
AVRLFGVRLDDDHGKKRRVQLVQEDEGDEQGSEG
Download sequence
Identical sequences A0A0D3FIU0
OBART03G18430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]