SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3GQP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3GQP0
Domain Number 1 Region: 304-439
Classification Level Classification E-value
Superfamily ApaG-like 1.7e-17
Family ApaG-like 0.0046
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily F-box domain 0.0000105
Family F-box domain 0.014
Further Details:      
 
Weak hits

Sequence:  A0A0D3GQP0
Domain Number - Region: 125-219
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000161
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3GQP0
Sequence length 442
Comment (tr|A0A0D3GQP0|A0A0D3GQP0_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART07G13430.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MASPAKAQRRPEGASVLETLPALPLAIIIAKAGPRCAAALACASSTLRAAASGEALWRHF
CSDDFALDAPLAPGDLPLPSFKDAYKAWFQSFGMYPLPLVKRVKIFWSSFRAWLCEYFPE
GLRTLGEGVSEAEIAVAECNLGLVLPMPTKLLYRFCNGQLHIGRGEEVSYGVMGGYDYVH
QRYTVRLLPLAHHAVQKNSNYIVVATSCFGEKIFLLDCASGRLYVGTKYWNEEREIMACV
PKATIRLAVDDDHGMPQDGFLLWLEEHLSRLQDGLIKVQSCKFPMLARHISLYPVQLPYC
SSASMHGIKVRASAVFAPENSAFADYRCRYSYYFSIRLSLPEAFVVDGKWYSSFQLQSCH
YTIQIGDEVLPYTCNYGGHGKCPLLRCGEELFVYGCSISAALEPGSVMGNLTLVPWRCGQ
PRGSPFIADIAPFPLHPPDYIF
Download sequence
Identical sequences A0A0D3GQP0 A0A0E0BHJ5 I1QZ62 Q2R7K1
OBART07G13430.1 OGLUM11G08710.1 ORGLA11G0080400.1 LOC_Os11g16330.1|13111.m01641|protein LOC_Os11g16330.1|PACid:21946739 XP_015615195.1.37577 39947.LOC_Os11g16330.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]