SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3H5G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3H5G6
Domain Number 1 Region: 202-448
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.51e-42
Family Ankyrin repeat 0.00062
Further Details:      
 
Domain Number 2 Region: 77-226
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000183
Family Pseudo ankyrin repeat 0.021
Further Details:      
 
Weak hits

Sequence:  A0A0D3H5G6
Domain Number - Region: 536-679
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0204
Family Voltage-gated potassium channels 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3H5G6
Sequence length 687
Comment (tr|A0A0D3H5G6|A0A0D3H5G6_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART09G06050.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MDHVAGVQFAEQIEQALRKADELGDDDLRAALRRARNSPADTAFELPLLQLPVEDPVHAG
AAATQPEQQNAGRRLMCPELYRAAFSGSVDKLQELLVSPSGTAAEEQGRRHDGQCVLDET
TAGLNTVLHLAAGQGKIGLVRKLCDGDDTAAAAVAALLPKETTKSETALHHAARAGRRDM
VSLLIRLAQMHGSGAPGLLVTKNSAGDTALHVAARHGRVAVVKVLMVAAPALSCGVNNFG
MSPLYLAVVGRSIGAVKAIVQWKHASASGPKRQNALHAAVLQSVEITRELLSWNSNLAKE
PDESESTPLHYAASDGVREIISMLIQSMPSAMYIPDKEGLTPLHVAAKMGHLDVIQDMLK
ECPDSAELVDNEGRNILHLAIERGHEPVVSYILGDPSVAELFNEQDKKGNTPMHYAVKAG
NPRLAILESRNIKLNIVNNEGQTPFDLASNTTGFLHMIGFLLRLSANGARFGAQRQDCIS
QWSSKNVKEWNEKTTKNLGIVALLIATIALTAMFNVPGGYNSDGVANLRATTPYNAFLVL
DTVAMASSVIATMLLTYGRGAARSSTAWICMSLIFLWMALMSMILAFMAAVVSGLDSTTT
KYILWSIFVLPFAFLVALSFVWAVPAPTFTTLLLLPRALAGEDSGWTRRRIGRRFRSVGV
YLLVLYLFWFLNAVAFFLTVYVVVNTI
Download sequence
Identical sequences A0A0D3H5G6 I1QN08
ORGLA09G0043700.1 OBART09G06050.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]