SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3HCP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D3HCP0
Domain Number - Region: 22-172
Classification Level Classification E-value
Superfamily TPR-like 0.019
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number - Region: 151-219,278-330
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0497
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3HCP0
Sequence length 459
Comment (tr|A0A0D3HCP0|A0A0D3HCP0_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART10G07040.3} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MMRLLAEMLRAGVDPDAATFTTVMHWLAHAGDVDAAMRVWEEMRARKGKCRPTLVSYTAC
VKILFDAGRPAEAREVFQEMVAEGLRPSCKTYTVLIEHLANVGKFEATMEIMDKMQEAGV
EPDKALCNILVQKCSRAGETSVMTRILQYMKENFIVLRRPIFLEALEALKANGESDNLLR
EVNPHLAFEGIECDPAFTDLGYITVRSTILYLLASRNWSAVEHMINEMTPKNIKVESHIL
SDIIQASCANCRPSCGLAVLRYSLRIGNGLDRSAYGSLLGHYIRNGSFDLVFEIVEILIK
SGCNLGTYLSSILIIKLACAGHSSTAVRIFGLLTTDKNVVTYTALMSAYFQDGKVDKALQ
LFSQMSANGVFACPGTYEVLIHGLQMAGRKQESEHYRRERMEMQWHLQYRNEHSPEDSLS
ESFQHLLLPEHDDIDTQDCCPKDVTHNEVWTVHSSAGDN
Download sequence
Identical sequences A0A0D3HCP0
OBART10G07040.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]