SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3HCP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D3HCP2
Domain Number - Region: 72-211,461-484
Classification Level Classification E-value
Superfamily TPR-like 0.00556
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number - Region: 270-338,397-449
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0785
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3HCP2
Sequence length 578
Comment (tr|A0A0D3HCP2|A0A0D3HCP2_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART10G07060.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MLRRSRHFLPPRPRRRPRPRHEAPAADPPTPTYTRDVVRRVDAILRGHPWSAARPLLLSL
PGLAWDSHTVARVLKAHPPLHKAFLFFRLAAGAGGGFRHDCFTYTSMLHLLGEAGRVPAM
MRLLAEMLRAGVDPDAATFTTVMHWLAHAGDVDAAMRVWEEMRARKGKCRPTLVSYTACV
KILFDAGRPAEAREVFQEMVAEGLRPSCKTYTVLIEHLANVGKFEATMEIMDKMQEAGVE
PDKALCNILVQKCSRAGETSVMTRILQYMKENFIVLRRPIFLEALEALKANGESDNLLRE
VNPHLAFEGIECDPAFTDLGYITVRSTILYLLASRNWSAVEHMINEMTPKNIKVESHILS
DIIQASCANCRPSCGLAVLRYSLRIGNGLDRSAYGSLLGHYIRNGSFDLVFEIVEILIKS
GCNLGTYLSSILIIKLACAGHSSTAVRIFGLLTTDKNVVTYTALMSAYFQDGKVDKALQL
FSQMSANGVFACPGTYEVLIHGLQMAGRKQESEHYRRERMEMQWHLQYRNEHSPEDSLSE
SFQHLLLPEHDDIDTQDCCPKDVTHNEVWTVHSIAYTE
Download sequence
Identical sequences A0A0D3HCP2
OBART10G07060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]