SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3HKG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3HKG9
Domain Number 1 Region: 180-359,455-546
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-38
Family Ankyrin repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 502-748
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.05e-36
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 29-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.12e-20
Family Ankyrin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  A0A0D3HKG9
Domain Number - Region: 312-447
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00101
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D3HKG9
Sequence length 961
Comment (tr|A0A0D3HKG9|A0A0D3HKG9_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART11G09310.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAVGTAATSNASGESSMDKHVPEAKDPNVLLITSAAGNTCLHISCAQDHEDFCKTVVALN
SSLLAAVNADNETPLITAAKRGSRASLSLASLLLKFCQCHQLSEAITQKDKKGCNALHHA
IRSGDSKLALELIKAEPALSRVSNNDEESPLFIAAVRNLTDVVGKLLEISDAAHGGSGKQ
NALHAAVKNGNPDIAKRIMEVHPWMAREEIGDDKPAATPMWRAVNDGKIDVVTVLLKYDP
SLGYLMTREGSSLLCTAGRNGHVAVAQELLKHCPDTPYCSETGWTCLHAAAYSDRIEFVR
FVLGSEQLRHLVNIQDKYGRTALHLAAEKLYSRIISALLLHQGIDVTLISNNGQTATAVL
TAALASRTDKDKDHTSDKDDYINEIWIPDSKAIVDSPVMDRGLLKVATLGVKPALHDPSL
LLGRTVQGNTCLHIASAHGHEEFCNDILVLNPSLLCTVNTDGETPLLAAVKCDNVSLASF
LLSYCCRCHDDLDMREAMVRQDKQGCNALHHAIRRGHRKLALQLIEKVPALTKAVNKHDE
SPMFIAVMRNFTDVFNKLLEVPDSAHGGTSGYNALHAAFRNNNTDIAKKIIETRPKLARE
ENSARTTPVQFGVLEDKIDVLKVLLERDFSLGYIVSTSGTPLLGSAAYRGHVGVAMELLK
HCPDAPFLDENDGTTCLHTAVQKGHIKFVEFVVQSKELRKLINMRDIDGETALHYAIRKC
HPKIVALLLQYKAQDVTVLDSNGNPPIWVPDDAADHAKTLNWSEVSMRMLKADPEDKGEI
YNLIKTIKDQVPEKARKDIRTLTKTYTSNTSLVAILLATITFAAAFTLPGGYSNNAGSEG
LPIMSRKLAFQAFLISDTLAMCTSLTVAFVCIIARWEDLEFLLYYISFTKKLMWFAYFAT
TTAFATGLYTVLAPHLPWLAIAICVVSVLLPILTKLIGEWPLLKLRIRLLGSFESDLIDM
V
Download sequence
Identical sequences A0A0D3HKG9
OBART11G09310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]