SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3J0B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3J0B3
Domain Number 1 Region: 2-173
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.7e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 178-262
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.29e-17
Family Anticodon-binding domain of Class II aaRS 0.00056
Further Details:      
 
Domain Number 3 Region: 294-375
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.0000000216
Family C-terminal domain of ProRS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3J0B3
Sequence length 375
Comment (tr|A0A0D3J0B3|A0A0D3J0B3_EMIHU) Uncharacterized protein {ECO:0000313|EnsemblProtists:EOD16948} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN= OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MEKDHIEDFAPEVAWVTKSGDGDLNEPIAIRPTSETIMYPAFRSWIHSHRDLPIKLNQWC
NEGHTAHATKEEADVEVLQILEFYAAVYEELLAVPVIKGRKTEKEKFAGGDYTTTVEAFI
PAAGRAIQGATSHGLGQNFGKMFRIEFEGADGKKAIPWQNSWGLTTRTLGVMVHGDDKGL
VLPPRVAPLQAVIVPITMKDVDEGAQLKTCGEIAAALREAGVRVHGVPLRLELGPKDMAK
QQIRVVRRDTNDKEDVPLSILPQKAALLLVQMRAARTPPPGRLTRDSYVAQALTWEDFMA
KIGAGNLEFEELVKKRSKEEALAAAGEEAEDDRAAISLAVKTLCIPYEAPPLPDGTPCFI
SGKPAVCWTLWGRSY
Download sequence
Identical sequences A0A0D3J0B3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]