SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D4CZN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D4CZN8
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.86e-78
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D4CZN8
Sequence length 144
Comment (tr|A0A0D4CZN8|A0A0D4CZN8_9ARCH) Methyl coenzyme M reductase subunit A {ECO:0000313|EMBL:AJT55663.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
YTDNVLDDFTYYGKDYVEDKYGGLCEAPNNMDTVLDVGTEVTFYALDQYEEYPALLETHF
GGSQRASVISAAAGCSTAFATGNAQTGLSAWYLGMYLHKEQHSRLGFYGYDLQDQCGAAN
VFAIRNDEGLPLEMRGPNYPNYAM
Download sequence
Identical sequences A0A0D4CZN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]