SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D4DDA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D4DDA2
Domain Number 1 Region: 167-316
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000314
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D4DDA2
Sequence length 499
Comment (tr|A0A0D4DDA2|A0A0D4DDA2_9ACTN) SMI1/KNR4 family protein {ECO:0000313|EMBL:AJT61796.1} KW=Complete proteome OX=47763 OS=Streptomyces lydicus. GN=T261_0104 OC=Streptomyces.
Sequence
MTSPQNPEITALLQRMAHSMAKGAPKGWQRASISACADQHSTGGHGPINLLANGKSRPGS
MRAPEYLKRVFELDDTGADELTIELVVHPDGRFEAMTSRAIVRQPGGAPGEAGHVYALRP
DVRPPDAGDLEAGPTDPTQAGDPPEAVRLLSAYIRKREEIFERGPGLQTLPDPRSADEIE
HAERALGVPLPDDLRALYAVADGDGGRRLLDRHIWLALDHVVSLHHADRWWAAGTTWKHF
TLGSVRSDGLPRPTVRASADRRGWIVFAESTGGDFLAVDMDPAESGRPGQVIRVGMHHDD
GPVYVADSVTELLRLHLAALERGDYRCDVAAEDGELWIETGLPRRHGDTAYRDTADGGSD
GADAAAEAPVHHAYVTCDAELAPLAGHPTLTTVTVQQAETAEALSLAPLRNCPRLYGLDL
SQAKVRDIEVLASMPGLRYLSMREEQWRTLTEHTGRPSGLAAAVLADASSPETLAAWAAS
LGGDADDIRFYTGRLPGHV
Download sequence
Identical sequences A0A0D4DDA2
WP_046924038.1.38279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]