SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D4DET0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D4DET0
Domain Number 1 Region: 11-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000602
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D4DET0
Sequence length 148
Comment (tr|A0A0D4DET0|A0A0D4DET0_9ACTN) SMI1/KNR4 family protein {ECO:0000313|EMBL:AJT62197.1} KW=Complete proteome OX=47763 OS=Streptomyces lydicus. GN=T261_0507 OC=Streptomyces.
Sequence
MWRDLAGRAYAGAGFRTPAGPAALSAAERRLGCPLPAELAGLLRETDGVAGPYGVDTVWP
LERIVEQNLHFWRDRSFAGLYMPFDALLFFGDNGGGDQFAFVRTPPRADVFVWEHEDDSR
RWVARDLRDYLGRSLAEGGDDWYQCGCR
Download sequence
Identical sequences A0A0D4DET0
WP_046924323.1.38279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]