SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D4DZ05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D4DZ05
Domain Number 1 Region: 204-299
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000215
Family Leucine-rich repeat variant 0.037
Further Details:      
 
Domain Number 2 Region: 27-83,112-188
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000144
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D4DZ05
Sequence length 308
Comment (tr|A0A0D4DZ05|A0A0D4DZ05_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AJT69020.1} KW=Complete proteome OX=47763 OS=Streptomyces lydicus. GN=T261_7422 OC=Streptomyces.
Sequence
MDARLRRIAAKLATVRDLLGRTHSIREESHRVLLGPPMPESRVVAFEEQYGIRLPPCYRS
FLTTIGNGGIGPDHGLLHLDDWDYVVLGAPIRPDHLSTPFPLSPTDPAPGPDWYHAFGPA
WLDDDDAEPYPGTIALTTRGCSLYTLLVVTGPARGRVVDVNLEFDVDAPSFTHDTDFLAW
YERWLDQTGNGMHSAALDVALRDDEPPMAAILRDSPKPELREVAAQGLGRAPILTPAVRS
LLGAAAVGDPAPEVRRTAVIMLGRRPTPADDDVLVRALTDASADVRESALQALAGRGSAW
HVQARGSA
Download sequence
Identical sequences A0A0D4DZ05

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]