SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5A8T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5A8T9
Domain Number 1 Region: 185-273
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 6.28e-18
Family Peptidyl-tRNA hydrolase II 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D5A8T9
Sequence length 274
Comment (tr|A0A0D5A8T9|A0A0D5A8T9_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:AJW39577.1} KW=Complete proteome; Reference proteome OX=1564114 OS=Rhodococcus sp. B7740. GN=NY08_1547 OC=Rhodococcus.
Sequence
MICDPMTGDDMTDGPVTDAGPDDLGGAEAAAEEFSPDNTFASRHAELARGYGGAEDPADP
SQVLAMPLVLHIPKSDPPRRSELLEAAARATVSLCLDPRVGAGASWNEAFTEWTSARIRK
VARRARGAHWLAAQDVPGVTVDVGGASARAFVPGRVGVLDPRIKRLQIGGTDVAAEDEPA
VSAGPVLWIDASLSMTVGKAAAQVGHASMLLAGAMGTEECREWAAAGYACSVRSANPDQW
TRALGEVRAGRAVAVRDAGFTEVAPGSTTVIAVL
Download sequence
Identical sequences A0A0D5A8T9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]