SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5LC10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5LC10
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily RibA-like 1.7e-50
Family RibA-like 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D5LC10
Sequence length 180
Comment (tr|A0A0D5LC10|A0A0D5LC10_9BURK) GTP cyclohydrolase II family protein {ECO:0000313|EMBL:AJY40720.1} KW=Complete proteome; Reference proteome OX=1468409 OS=Burkholderia sp. 2002721687. GN=BW21_5635 OC=Burkholderiaceae; Burkholderia.
Sequence
MVTFQGLCDSAEHLALVFGPLADAPLVRVHSECLTGDVFGSARCDCGEQLDESVAMFGRE
GGILLYLRQEGRGIGLYNKLDAYRLQIAQGLDTFAANRALNFPDDMRDFRVAAQMLQALG
VTEISLVTNNPDKVSQIERHGIRIRRVRQTGVFVNTTNHGYLRAKIDHHRHAINLSQELQ
Download sequence
Identical sequences A0A0D5LC10
gi|488605394|ref|YP_007920094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]