SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5NM54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5NM54
Domain Number 1 Region: 49-111
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00000111
Family Copper amine oxidase, domain N 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D5NM54
Sequence length 187
Comment (tr|A0A0D5NM54|A0A0D5NM54_9BACL) Copper amine oxidase {ECO:0000313|EMBL:AJY76409.1} KW=Complete proteome; Reference proteome OX=1126833 OS=Paenibacillus beijingensis. GN=VN24_19855 OC=Paenibacillus.
Sequence
MKLKKPFILLLAMSLWGGSMIFADSAAQTVRVIVNGSVLDEGGIINDGKTYLPLRQLASS
LQAIVAWDEQSKKVTLFKPNVHMFLFQDSKIFGNVDRGNKYTFNVFAQIDNLLTDISAVK
VSIFDPSGRETVIDFKNINVSKDNFWYRTEDVKYNFDSSGKYAVRFFMKVNASDDWKLVS
EKLISAQ
Download sequence
Identical sequences A0A0D5NM54
WP_045671836.1.39863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]