SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5V9S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5V9S5
Domain Number 1 Region: 11-121
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.01e-39
Family N-utilization substance G protein NusG, N-terminal domain 0.0000767
Further Details:      
 
Domain Number 2 Region: 129-185
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D5V9S5
Sequence length 185
Comment (tr|A0A0D5V9S5|A0A0D5V9S5_9BURK) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=134537 OS=Paraburkholderia fungorum. GN=OI25_1754 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDQFGQILVPTEEVVEVKGGH
KSVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRPSPISPREVEKIMSQMQ
EGVEKPRPKTLFEVGEMVRVKDGPFTDFNGSVEEVNYEKSRVRVSVTIFGRATPVELEFG
QVEKL
Download sequence
Identical sequences A0A0D5V9S5 A0A0M4PS49 A0A0N0ZCG9 A0A160FPE3 A0A1A9NG22 A0A1H5CJM6 A0A1I7ESB7 A0A1M6YMN3 A0A1N6H5I5 A0A1N6L8A1 A0A1N7SBW2 A0A1X0MF80 A0A211YSQ1 A0A248VGA3 A0A2C8ZE16 B2T764 E1TBW2 E8YHB4 I2IFB9 Q13TF7
266265.Bxe_A0301 398527.Bphyt_3657 gi|187925629|ref|YP_001897271.1| gi|91785478|ref|YP_560684.1| gi|323527615|ref|YP_004229768.1| gi|307731268|ref|YP_003908492.1| WP_007180147.1.100893 WP_007180147.1.1119 WP_007180147.1.1202 WP_007180147.1.17054 WP_007180147.1.17773 WP_007180147.1.22724 WP_007180147.1.22769 WP_007180147.1.23844 WP_007180147.1.25516 WP_007180147.1.30149 WP_007180147.1.35367 WP_007180147.1.37284 WP_007180147.1.38508 WP_007180147.1.42974 WP_007180147.1.45576 WP_007180147.1.46400 WP_007180147.1.47020 WP_007180147.1.5233 WP_007180147.1.53296 WP_007180147.1.59832 WP_007180147.1.61235 WP_007180147.1.64023 WP_007180147.1.65178 WP_007180147.1.66891 WP_007180147.1.70841 WP_007180147.1.75206 WP_007180147.1.77272 WP_007180147.1.78186 WP_007180147.1.78764 WP_007180147.1.82249 WP_007180147.1.83274 WP_007180147.1.9204 WP_007180147.1.94246 WP_007180147.1.944 WP_007180147.1.96445 WP_007180147.1.99484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]