SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5W840 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5W840
Domain Number 1 Region: 60-89
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0000114
Family Cell wall binding repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D5W840
Sequence length 91
Comment (tr|A0A0D5W840|A0A0D5W840_9STRE) Uncharacterized protein {ECO:0000313|EMBL:AJZ74490.1} KW=Complete proteome OX=1419814 OS=Streptococcus sp. VT 162. GN=V470_10995 OC=Streptococcus.
Sequence
MKTSHKDKEGNDIPGHPTEDGQQPKKDIPGYRFVETKITSPSIDKFTKEEANYAIQKLNL
PSEGSYPRNKWVGYYYYKSDGKMAKNEWVDG
Download sequence
Identical sequences A0A0D5W840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]