SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5WYD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5WYD5
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000301
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D5WYD5
Sequence length 212
Comment (tr|A0A0D5WYD5|A0A0D5WYD5_9ENTR) Beta-1 3-glucan biosynthesis protein {ECO:0000313|EMBL:AJZ90657.1} KW=Complete proteome OX=1134687 OS=Klebsiella michiganensis. GN=VW41_17280 OC=Enterobacteriaceae; Klebsiella.
Sequence
MLLNALEKWLKQHLPEIAADLNPGVDEHLLDTFSRRLNAPLPDAFKALYRWHNGQRMAIH
SGPWYGLSFLTLEQVIKELDDWQSVIAGLPSEELREMNATMSSTPPGFVKCEYSNPLWIP
FAYDYGGNYLGIDLAPGMKGHYGQVINFGRDEKRKIAVAPDLNSFIMWMLKELKLGNVNI
REEEDGGRSFNTLHPEKYHFLDSLAGMFPAQK
Download sequence
Identical sequences A0A0D5WYD5
WP_045783556.1.10023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]