SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6BL43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6BL43
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000109
Family SMI1/KNR4-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6BL43
Sequence length 85
Comment (tr|A0A0D6BL43|A0A0D6BL43_9PSED) Uncharacterized protein {ECO:0000313|EMBL:BAQ75878.1} KW=Complete proteome OX=1500686 OS=Pseudomonas sp. Os17. GN=POS17_4184 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNFSEFEQLLDAKKSLHPIWFELPSDRTATEEDIIEAQNDLDLRLPAEYSQFLQKHGGGY
FALGIVYSRTETAISTWPESIDNTH
Download sequence
Identical sequences A0A0D6BL43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]