SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6BP65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6BP65
Domain Number 1 Region: 53-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000068
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6BP65
Sequence length 209
Comment (tr|A0A0D6BP65|A0A0D6BP65_9PSED) Cell wall assembly/cell proliferation coordinating protein, knr4-like protein {ECO:0000313|EMBL:BAQ76690.1} KW=Complete proteome OX=1500686 OS=Pseudomonas sp. Os17. GN=POS17_4996 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSEQHAPHADWPPAGCPPLAWQDLPDQSARLSWYLAVIGAYGALWEGHVNEPELTPVSEE
ALVALEQRLGCTLPSSLRDYHRQLGVLSLAEILCSVGPGHTPIQPLLEAYPGIVDIPESD
LDLTLAHQLVAFGDYLGNGNLFCFHRDSGAVYYFDHDTGVALTRFFDSPEEYLDALMLLC
IAEVYEDDDGAEALISQRYGDDLVRKWRY
Download sequence
Identical sequences A0A0D6BP65
WP_060840923.1.76993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]