SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6BSP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6BSP7
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Rubredoxin-like 7.24e-23
Family Rubredoxin 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6BSP7
Sequence length 55
Comment (tr|A0A0D6BSP7|A0A0D6BSP7_9PSED) Rubredoxin {ECO:0000256|PIRNR:PIRNR000071} KW=Complete proteome OX=1500686 OS=Pseudomonas sp. Os17. GN=POS17_6065 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKKWQCVVCGLIYNEAEGWPDDGILPGTRWEDVPEDWLCPDCGVGKMDFEMIEIA
Download sequence
Identical sequences A0A0D6BSP7 A0A2J7U5P1
WP_025130776.1.46796 WP_025130776.1.74391 WP_025130776.1.76993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]