SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6EI41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6EI41
Domain Number 1 Region: 319-465
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-30
Family cAMP-binding domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 459-591
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-26
Family cAMP-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 67-104
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000123
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6EI41
Sequence length 638
Comment (tr|A0A0D6EI41|A0A0D6EI41_SPOSA) SPOSA6832_01119-mRNA-1:cds {ECO:0000313|EMBL:CEQ39586.1} OX=5005 OS=Sporidiobolus salmonicolor (Sporobolomyces salmonicolor). GN=SPOSA6832_01119 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Sporidiobolus.
Sequence
MQPIKPPLPVPPAPRAPLPAPGQLHTPSTCPSRADFAGATVLELQPSGTSPVSASLSIQS
NAFLMSFPSSYSAILSELNREVLRAQPTDPLQFCANWFASRLEQERNAFRSGVSSGSLGP
IDDSTMRETTPPHSASPAGSSASKQSKPRLSGTPFNQPYSFGVSQGGPRALVADDKPSPY
SEHPPNAEPGSPFSRVASASSNIPSSFPSSQPAAPLSFTGPLRLGKSGATTPPGSASPKG
AAAPESRHTRHVSNDSGSDVEDPRDDPNYHPSKAGSPFGPNGVGAEGGIAAAYNLGRRTS
VSAESLDPSANISLPKTVIPKTPSQRARIETSIANNLLFRNLDEDQHHDVLNAMKEVTVQ
AGTEVIVQGAVGDFFYVVEEGAFEVWVRGPPTHTYAGPGQSITQPGEEKKVAQYGPGGSF
GELALMYNAPRAATVVAMSRATLWALDRVTFRTILVEHTSRKRRMYETFLSEVPILQTLN
AKERAKIADALEEKMYEEGEAVVVEGEVGKNFYIIESGRAEVTKRRKSAQGGFDEEVLGT
LGKGDYFGELALINSAPRAATVRAVSGQGRLRVATLGEKAFTRLLGPIIDILARKAERSY
GPGAAVNASLGEANGRGGPGGERRESFVPGEERRGDGL
Download sequence
Identical sequences A0A0D6EI41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]