SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6EYG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6EYG0
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily DEATH domain 1.45e-25
Family DEATH domain, DD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6EYG0
Sequence length 137
Comment (tr|A0A0D6EYG0|A0A0D6EYG0_ONCMY) Interleukin-1 receptor-associated kinase 3 {ECO:0000313|EMBL:CFV75262.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=allele OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MDSSMYLYDVPPVLMEKFCKIIDSGDDSLGWRGLAARIIVPSWTEVRRTERLEAIGKSPT
RELIWAWAQQNKTVGDLVKVLEDMCHYRALQLFSPQETQYSFPNSGPSKSSRDNPSPPHS
PAKPQACDHLLRRHRGN
Download sequence
Identical sequences A0A0D6EYG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]