SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6I5Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6I5Z4
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000262
Family SMI1/KNR4-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6I5Z4
Sequence length 135
Comment (tr|A0A0D6I5Z4|A0A0D6I5Z4_ALCXX) Uncharacterized protein {ECO:0000313|EMBL:CKH82913.1} KW=Complete proteome OX=85698 OS=Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans). GN=BIZ92_20095 OC=Alcaligenaceae; Achromobacter.
Sequence
MNELTALVERNHATIRPARGEDIQQLGESLGFALADEYVDYLSTFGVIVFGATETYGLGV
PPDYYLNVRNMYADLSRDATYPRLAVPLVDAGDGRYYLYDNGSRRILLWATPNGGIVQTL
NEGLEAFLVKQIFRP
Download sequence
Identical sequences A0A0D6I5Z4
gi|568129167|ref|YP_008925814.1| WP_006384258.1.1102 WP_006384258.1.2494 WP_006384258.1.30196 WP_006384258.1.41161 WP_006384258.1.47990 WP_006384258.1.70984 WP_006384258.1.76099 WP_006384258.1.84051 WP_006384258.1.88089 WP_006384258.1.90725 WP_006384258.1.93368 WP_006384258.1.99476 WP_006384258.1.99933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]